SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.203173|PACid:15701701 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.203173|PACid:15701701
Domain Number 1 Region: 98-228
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.63e-24
Family GntR ligand-binding domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 5-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.79e-18
Family GntR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.203173|PACid:15701701
Sequence length 243
Sequence
MKTAPTTLSETLTQDLARRIIRGDLPPGLSLPGENELAQQYEVSRTSVRNALQVLAAKGL
ISIQAKKRSTVNSRQQWSFLDTDVLAWLAEDSLDPLLIEQLMVTRLIFEPNIAALAAVNA
TGHDLAALEDACKLMAQGQQQASRELFEQGDMAFHLALLGASHNPFLHSLGSALSAAMAL
SFQQTLEEDVRLAQKAVEEHQQLLEAIRFKQVENARQCMRVILLNAARKNNWHKQPEMFA
HIL
Download sequence
Identical sequences A8G9M7
WP_012005162.1.18676 WP_012005162.1.35080 Aqu1.203173|PACid:15701701 gi|157368956|ref|YP_001476945.1| 399741.Spro_0711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]