SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.203343|PACid:15701871 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.203343|PACid:15701871
Domain Number 1 Region: 4-162
Classification Level Classification E-value
Superfamily SIS domain 2.62e-28
Family mono-SIS domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.203343|PACid:15701871
Sequence length 171
Sequence
KKSLNNVLTILEDCQGQIFTSGIGKSGLIANRLAASLSSIGVSSQYVSAVEWRHGDLGKL
TPGRDVCIFISHSGSTDETVEAAASVLAKGVTTISITGKQGTATQPHTFKYAYIHIDINE
EPFGCLPTTSLAIQDILVNAIVSELILRKGVTEKDFGRNHPGGTIGSRLGR
Download sequence
Identical sequences Aqu1.203343|PACid:15701871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]