SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.204548|PACid:15703076 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aqu1.204548|PACid:15703076
Domain Number - Region: 320-356
Classification Level Classification E-value
Superfamily SOCS box-like 0.000118
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.204548|PACid:15703076
Sequence length 360
Sequence
VNLYIGRDLYKSEVCSIPATITDSQYAVFTSDSAAVQILVCDDPSVLFWADKDDDRIQKF
GISSMGEIHYEPSDRRQDYLIGRTVPNQDTYFNWSRNKVKLPRDVCLLGNVEFSSSQLGV
PNKIETYYSSMTNSYQVLCAYRVPTPIYSFTRTWKWVPASNGLLPPGAIPGGRDESSEVI
YIARAFHENEVPAGYVSPSQKCCIYPWGCTTHQTLNYEVLVVEDQNSLKWERASDGDLPV
GAVTSNEEGEQETGVGRTLTDTDLSVGITFDGISINIPQRACRDMQLLGKIPIYHRCLYI
PYKNKEFIYREYEALRSLFSANSLQQLCSYVILESVHAVPDCINSLPLPKKIKDDLLALI
Download sequence
Identical sequences Aqu1.204548|PACid:15703076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]