SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.204918|PACid:15703446 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.204918|PACid:15703446
Domain Number 1 Region: 195-340
Classification Level Classification E-value
Superfamily TRAF domain-like 9.16e-44
Family MATH domain 0.00000281
Further Details:      
 
Domain Number 2 Region: 16-55
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000229
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 
Weak hits

Sequence:  Aqu1.204918|PACid:15703446
Domain Number - Region: 51-101
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000216
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Domain Number - Region: 128-188
Classification Level Classification E-value
Superfamily PhoU-like 0.0251
Family PhoU-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.204918|PACid:15703446
Sequence length 356
Sequence
MVKFTPDKSLREEICSLFIKCPNNKFGCGWVDTIGALSEHVSCCMHRKQECPHCNEDFAM
TEYQPHVDECPKMIVNCPLKDHGCKETNEMTREECINHLSSNDGLFDHVVMMVAALSSLP
TNPLKSESLESFANLVRGSSGSVEDGVRGAIESFVTMVAELIAEITKKDSQICTLEDKVA
QLETITMSFCYGNFDGSMVWKIPQFSQRMDDARTGKYTSIFSLPFYSSRYGYKMCLRLYI
LGDGIGKGTHMSLFFVVMKGEYDALLPWPFTHKVTFKLMNQCSKRDVVKAFQPDPLSSSF
QKPKSDMNVASGCPRFVSKNELMEGGFIVDDTIFIKVKLYRVYRHKMTQRNMKDYN
Download sequence
Identical sequences Aqu1.204918|PACid:15703446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]