SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.206271|PACid:15704799 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.206271|PACid:15704799
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-28
Family Ankyrin repeat 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.206271|PACid:15704799
Sequence length 176
Sequence
KNNWPDVASTLITKYHCNPEAINNRKSTPLHYAARYGSMETLKCLIIEHDCDPMSFTRNE
WTALHWAASTGQVDTLRYLIESCNCDPSLCDTKGHNLLHLACAGNHIESARYLLQTGLID
PAFTCIWDCKPSEWGQSTSNGNTETIELLKYYEECRMNSPIDTVVTEWRELDLRIL
Download sequence
Identical sequences A0A1X7T447
Aqu1.206271|PACid:15704799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]