SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.210980|PACid:15709508 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.210980|PACid:15709508
Domain Number 1 Region: 16-107
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 1.19e-31
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0000479
Further Details:      
 
Domain Number 2 Region: 108-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000584
Family Prokaryotic DksA/TraR C4-type zinc finger 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.210980|PACid:15709508
Sequence length 147
Sequence
MATGRRRKEGDYERPDFKPYKEKKGEEYMNPHQVEHFRAILLGWKKKLMSGVDHTLNHIQ
DQSANFPDPNDRATQESEFALVLRTRDRERKLIRKIDETISSLNNGDYGFCETCGIEIGI
RRLEARPTATLCYDCKVIDEIREKQKG
Download sequence
Identical sequences XP_019858550.1.10788 Aqu1.210980|PACid:15709508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]