SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.211122|PACid:15709650 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aqu1.211122|PACid:15709650
Domain Number - Region: 11-88
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00549
Family GntR ligand-binding domain-like 0.0098
Further Details:      
 
Domain Number - Region: 164-270
Classification Level Classification E-value
Superfamily t-snare proteins 0.0549
Family t-snare proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.211122|PACid:15709650
Sequence length 290
Sequence
LLVKETEIQQLKDHQTEKEQLLEQVRSITDDDDIFGFFDTQTERLMGLESDKNQLNLIIN
ELQEIIDNNNEKIREQEVELSYYSELKRDHELLKTQQLSLEYKLETYQTEHINSEGELLK
RLESLKEDNEILQERINALTMENDTISTRLEETTLELTSCKGRLSLSEEQLNRLQEQEEL
TFKEKEELRSSLEILQEEKSKLQQEYQEIVKENASLSGHRNLRQRIQFHADLKEKYHKLL
EDHRVLEEKFQSNSAAVAQALLMSKDQPVPSQQRVTRSKLKGKENISKIV
Download sequence
Identical sequences Aqu1.211122|PACid:15709650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]