SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.212047|PACid:15710575 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.212047|PACid:15710575
Domain Number 1 Region: 7-286
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.84e-70
Family Motor proteins 0.0000113
Further Details:      
 
Weak hits

Sequence:  Aqu1.212047|PACid:15710575
Domain Number - Region: 1067-1144
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0392
Family GntR ligand-binding domain-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.212047|PACid:15710575
Sequence length 1346
Sequence
MEKEGESITVFIRVRPVSSYDTEPVPATSSCISVTTPTTITINTKPDPKLFTFDHVAEHN
TTQWSDWFREDVHNDRESIKRGVYVDGIVEEIVTTATETYQVLLRGYTNRRVAGTSMNRE
SSRSHAVFMLSVESKLKEGDDGVCKIRSSKLNLIDLAGSERQRDTLTDGIRLKEAGSINK
SLSVLGNVITSLVDISNGKQRHIHYRDSKLTFLLRDSLGGNAKTTLIANVHPLSRCFGET
LSTLQFARRTKMIKNKVVVNEDMSGNVTQLQNEIKKLKQLLSTNQNAVGGAVGCGQDNSK
EIGCGSIAIQFLLEKVDKLQELNKRREKSLQSIKMILKLRDSHISKLESKTLPTTDDIIK
RQQEEIKELNRCIDHNPMVTKFAAENIELRGEVKRLQSLSVGDGLWAELTQLKTYTRQLE
KQLSGRVKEEAGPSVAMETSKLNCEIEKLHKRCQKLQTEVTMAQDQLNLEREENKVKIFS
LETSLKTSNKKVKDLQVRDTQYSNTLTDLTNNYWLASCSFPPITSTAAYLLIRIKLCCPN
AALPKASNKTKGPCTIVQGPLCTIDSLKVSHSIEREQANTTMKTIQAVTTPLLARSKSVT
STPVSIRGVGGVKAVAMGGVKRQFFSPLLPIKRNLAEELIEEEGTGLGKGVEPVEQEEVE
SAKKGAEPEEEKGAESSGNDIHELLETIQKLQTSNNELIKKLESSEVNVTSLKSDNELLG
MKLTEMESFYKQEHQQLEQQINELQTNIQEMTSRNTMLGEEVVDLRVCLGSADKELIEVK
KEKEKIETENKQTMEKVSDLEHQLITKSSEADTVIQQLTTIENELETLKDELLYKDDLLT
GKDKETLELNQTIKSLQTNLQELEDVVAMETDKSDRLMRERAGSEDELTLVMNERAGLMK
ELTSLKEEYESKVNLLSDELQSLSSSSSLLQSQCSDQLSIINELTQSVSSLKDSNNTNGA
LLDNMRLELEEKGRSLSVAMTTNEELVNKVDSLLIDISSNKEKHNKEIQAKDIQCEILVE
EVDYLNKLLTELQTKLETAEKESEEKTQSKAAMEEQLLVKETEIQQLKDHQTEKEQLLEQ
VRSITDDDDIFGFFDTQTERLMGLESDKNQLNLIINELQEIIDNNNEKIREQEVELSYYS
ELKRDHELLKTQQLSLEYKLETYQTEHINSEGELLKRLESLKEDNETLQERINALTMEND
TISIRLEETTLELTSCKGRLSLSEEQLNRLQEQEELTFKEKEELRSSLEILQEEKSKLQQ
EYQEIVKENASLSGHRNLRQRIQFHADLKEKYHKLLEDHRVLEEKFQSNSAAVAQALLLS
KEQPVPSQQRMTRSKLKGKENISKIV
Download sequence
Identical sequences Aqu1.212047|PACid:15710575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]