SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.217324|PACid:15715852 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.217324|PACid:15715852
Domain Number 1 Region: 314-447
Classification Level Classification E-value
Superfamily RNI-like 5e-20
Family 28-residue LRR 0.0092
Further Details:      
 
Weak hits

Sequence:  Aqu1.217324|PACid:15715852
Domain Number - Region: 147-252
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00706
Family C-terminal domain of PLC-beta 0.018
Further Details:      
 
Domain Number - Region: 3-96
Classification Level Classification E-value
Superfamily PhoU-like 0.0654
Family PhoU-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.217324|PACid:15715852
Sequence length 470
Sequence
MERIDQRRSLDDKKTTLLTVMQEIVSSDYRKLKDIATVLSDVEETRDIANKIMTEYEEKI
PQDDDSTVVQPQVGVVSNEDRASDILRNSYSALSQSITEPVRMAKWLHEEVVISDEALSC
VMSTRGSVSDSRAVLLKAVRDAVHSNYKHLELFVTVLQKDLKESQCINVQKEEVIDELKE
KISSLKEEKTVNKESIIKDTEKELESFKELSENRQKTKQKLENNSNSLVKEIPNDSDIFT
DELPNNDDSSDTDTPSEIDSDAPIPIKADAEVQVKRSQYSMRLSNPSLDQCEKLISKLKD
TNKSVILIHSSSDSTQFLVPIILERGTISQLNIYSSLLTRDDILSFSSQLSTNKSLTTLV
LTTGSMSDDGIIALAQSLLHNEALENLHLNDNPGITSDSARSLAELLLINKKLQYLRLHH
TSIDTDGVMMLMESLVTNDTLVKLWLDKQHEKTCFASPHYKAIESILYFL
Download sequence
Identical sequences Aqu1.217324|PACid:15715852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]