SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.218247|PACid:15716775 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.218247|PACid:15716775
Domain Number 1 Region: 60-174
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-23
Family SH2 domain 0.00039
Further Details:      
 
Domain Number 2 Region: 169-215
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000562
Family SOCS box-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.218247|PACid:15716775
Sequence length 222
Sequence
MIAGQTLIPAQYLNQMLNQPEREEEEEEIKNYITADVVKRKRTSKVSGRSPFAHRVSLHD
ILHHLKLCGWYWGELSSEEADSILHTASDGSFILRDSSDACHLFTLSLKAHRMVISVRVH
FSRGLFKLDSSTSDCPSFHSVVDLIYYYLSDSHRFFYVDVPGYGEVRVTLKHPILKEVLP
LQHLCCISIVRSCRTQGHIETLPLPAHLKRLLLEFCSESSSS
Download sequence
Identical sequences A0A1X7UK72
XP_003387675.1.10788 Aqu1.218247|PACid:15716775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]