SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.218295|PACid:15716823 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.218295|PACid:15716823
Domain Number 1 Region: 12-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-23
Family SPRY domain 0.0031
Further Details:      
 
Domain Number 2 Region: 182-227
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000051
Family SOCS box-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.218295|PACid:15716823
Sequence length 237
Sequence
MSSKEKEESQDFAWRWRLEERQVPAVLSEDRLSVVFHPRQSNGCLAIKGDCPLLKHMEHW
FEVELSPPLHGQARMIGLGDKYTRLQSNSKDFSPLIGRDCSSWGLNYNGKTLHDGETRDY
AEAPERSAPLKMGLYYDSYYGNIAFMLNEKNCGIAFQNIAVNLDLYPLICATPRGCQMKL
TYSYSSVISLKALCRGSIRLCVQDEELIEKLPVPPHLKAYLLFKEYQMPKSYYHNYY
Download sequence
Identical sequences A0A1X7UK41
XP_011404824.1.10788 Aqu1.218295|PACid:15716823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]