SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.220594|PACid:15719122 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aqu1.220594|PACid:15719122
Domain Number - Region: 361-396
Classification Level Classification E-value
Superfamily SOCS box-like 0.00017
Family SOCS box-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.220594|PACid:15719122
Sequence length 404
Sequence
MAMMASPKLHSHIRWERYNHAPKSIPSNAVVGGKTEKGVNIYIGRDLWKRDVCSIPATKT
SSRYAVFTSDSASVEILVCDNHSILFWADKGDDRIRKFGIGPMGEIHYEPYERRHGYLIG
RTVPNQKTHFNWPRPKVKLPRDVCLLGHLDLSSLQLSVPNKTELYYSSTTDSYQVLCAYR
VPIPVYSFTKTWKWVPASNGYLPPGAVPGGKDESGEVIYIARAFHENEVPAGYVSPSQKC
CIYPWGCTTHQTSNYEVLVVEDQNNLKWERASDGDLPVGAVTSNEEGEQETGVGRTLTDS
DLSIGITFDGIRINIPQRTSKDMQLLGKIPIYHRCLYIPYKNKEFIYREYEALKSLFCAN
SLQKLCSYVILESVHAVPDRINSLPLPKKMKDSLLTLIRYQLSD
Download sequence
Identical sequences A0A1X7UTU9
XP_019852231.1.10788 Aqu1.220594|PACid:15719122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]