SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.221110|PACid:15719638 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.221110|PACid:15719638
Domain Number 1 Region: 99-255,355-581
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.31e-30
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.017
Further Details:      
 
Domain Number 2 Region: 750-850
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000615
Family PKD domain 0.0064
Further Details:      
 
Domain Number 3 Region: 872-938
Classification Level Classification E-value
Superfamily PKD domain 0.00000000111
Family PKD domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.221110|PACid:15719638
Sequence length 1367
Sequence
MQAVTRQGFLFLLFLFSFLFGSTLAVVHGPKLPKGAVRQPLVVKIDSLDEPLGSVYQKAT
KQAREQAEKEDKEDSSLSRERQLRSLPDVAPNGFGTTVVLENDPHTFALVHWSGLPKKRI
FILTRDRDSDGNSRESYLWLSTDYGKSFQNITGRVYSNQIILEWYYVSSDADKLIFADVI
HRNIYVTLDEGDTFIEYHVNFSPDKFTFQHSYVPNVAKYDSYVLGYDNTLQTLWVSNNTG
ATWSKLGANVTRYEWRQLNSTYEDGSTVYFDMKINATACQLYKATLSTYNSSSQPLFDAS
LGVFMPNSFALSYQYMFTQRNYSDVGRPTTGYISPLWVSHYRKAFKAASFSLQLDERHYA
MVDGSEGQVLMGVYHDPNNTNLYISEEAGLNYSLSLEHLISPPESDWIDSYPTFDVYVVE
GIPGTYLVNRRVYGSTQGATVISFDKGGEWKPLNPPTTDASGHLINCNLPCSLHLHMYID
ESHGFQPILSQDSAPNIIMALGNLGLSLNRYNYYALRLYISDNGGVTWRELASGYKEFQL
INFGVFTSIVAKWTQTSTVQSSCDEGQNWSTYTFTNASVSQRIYVVRMFTEYGEESQHAT
VFGYRPDATYANFEWLVIDLDFTVLNISNCNASDYYQWRPTDEREGQLCILGESVEYERR
YPDHCCMISSDYERPISRKPCFCTFEDFECQVGFERVGLSGECSPMAGTVYPPNPPIDCF
EGNNYSYPSPYRRIAGDKCKDGNETFYQSVMVRCPVLPPADMTITTDNYHVRANTEVTFT
LEQRSGGKAVTFYSWSFDDNTPTSSPPIKGFDSASTQRYTYTVPGAYNVTVFAKNDAGNN
TAHITIFVLDKVVDFTVMPKIARVTQKSVYFLENITTLHNTLFIEPGTYTWDFGDNTPTE
TEDIKAVEHTYWNIGNYTLTVTFANIYGIKMNHFPILVENVTSPLHLNATLNSNPLQTDS
FIPVGKEVLFTVTPYQPDTTYDWVISHAGAHGGTPLLNSVGTATSKSFTFSEAGRYVVRV
SNPIARATLTFKQPVYRINKQVDAVLAVLGSSSSYSGNLYINLHSGDSSSSTSGSQDSTA
LLSTFLTVANGATTFSFIAPEAGTVSVNAELHNNVSSVTTKQTLMVAGPGAYGYVRVIFK
TLTKFDYNDYQVQLDVQNGVKNKILSSYAVLKWQLSVNVSLESNATVVSGPRKRSGAADQ
QYLIAHVTILPKTLSSDDVLKVQTLSKTIAADINDGNTTFTVRNTTLKATADLGPTIFIY
DPYPVDHNSKDYKPLIIGLGTGTVLLVVVALVIVGVVIYYYKKKYRSLEVRYTRLRQGPM
RFTFSSEGETLEEEDWRNDEEDTGVGEVEEEINNDEHTLHSFPPINS
Download sequence
Identical sequences Aqu1.221110|PACid:15719638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]