SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.221526|PACid:15720054 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.221526|PACid:15720054
Domain Number 1 Region: 22-219
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-25
Family Kelch motif 0.015
Further Details:      
 
Domain Number 2 Region: 166-362
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-24
Family Kelch motif 0.013
Further Details:      
 
Weak hits

Sequence:  Aqu1.221526|PACid:15720054
Domain Number - Region: 371-402
Classification Level Classification E-value
Superfamily SOCS box-like 0.0445
Family SOCS box-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.221526|PACid:15720054
Sequence length 427
Sequence
MAAFKSNDAPFAERPSTFRGYKWTNWEDCGFSDRVNHAMSSAGGSAYALGGFSGRGKSIR
TNESWNDLGDVPLDVQRFDTDSSTWERIYPPKEVEIHIPSTTNSRIDCPPLDYSEFISGR
YAHSCIYYRGKLYMYGGRNDYRFFLNVDCFDIESRKWSVLKTSQDNVPLGRYAHGCTLRG
SIMFVQGGTMLDPSSHQSLRYTDTLLSCNLETGQWQIEPVEPILNEENSPLQVLKRDFHS
VVYTNGRIVVFGGKCYFPNQDDDGFYEYLFGTSRWAKIDTAGYQPPGRRSLQGITYGQKS
IIYFGGFSTRKKIFYSDLFILDTDTRHVLKVIPYGLGPCPRRRVGMCLIGSDVIICGGVG
RNQSKEKHDHSLLTFVPSLQHLCIESIIKYQLPVEILPVSIKQHIYTLSNEECSDSQPLS
GDLYSND
Download sequence
Identical sequences Aqu1.221526|PACid:15720054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]