SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.222277|PACid:15720805 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.222277|PACid:15720805
Domain Number 1 Region: 32-157
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 3.53e-53
Family N-terminal domain of cbl (N-cbl) 0.00000368
Further Details:      
 
Domain Number 2 Region: 274-350
Classification Level Classification E-value
Superfamily RING/U-box 3.74e-34
Family RING finger domain, C3HC4 0.0000679
Further Details:      
 
Domain Number 3 Region: 206-266
Classification Level Classification E-value
Superfamily SH2 domain 5.47e-28
Family SH2 domain 0.0000785
Further Details:      
 
Domain Number 4 Region: 160-214
Classification Level Classification E-value
Superfamily EF-hand 0.000000000109
Family EF-hand modules in multidomain proteins 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.222277|PACid:15720805
Sequence length 416
Sequence
MARPGPSGGGKKGFLSFFHQQLQSGSTPKPAIDKKTVEKAWKLMDKVVNLCANRRMNLKN
SPPFILDILPETYQHLRKIFKNYETQLDFLNDNDYFKIFMENLTNKCKQASQLFKEAKEK
IYDETSSHRRSLTKLSLIFSHMLAELKALFPDGIYAGGSYRLTKLDASDFWTSSFGSKAI
VPWRTFRAILHQCHPIHSPLEAMALNYIFRLSCTRLGQWAIGYVTVDGSILQTIPQNKSL
CQALIDGARERFYLYPNGEDYNPDLHEIISPAQNKHIQVSQEQYEIYCEMGSTFQMCKIC
AENDKDVKLEPCGHLICHVCLQSWLESGRADCPFCREDIKDSEPVVVDPFSNRNSSDNGP
KHDATYSLATELAMNLGGGGAGGGAGEVGGGGGEGSEGNGKSDTAIASTTGEEEFE
Download sequence
Identical sequences Aqu1.222277|PACid:15720805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]