SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.223273|PACid:15721801 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.223273|PACid:15721801
Domain Number 1 Region: 173-239
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000916
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.223273|PACid:15721801
Sequence length 580
Sequence
MASHPPFHQIFWEFQLSGLVGDIYSYPLTIDDSAASLLDCIVKSTSFVISLPKYFIDSLI
TVHNQMATLLNDTGNGLQLFRDTAAPSVAIAIQGNINIMTQDGFRAYSVFEVNGYTGSIK
DIVYTSTGIVLLIDQEIIALMNESTSIHSPSGLTSSILENNVFHITGRGRDIIYDNYDIV
IAWSHTVMLLYVSIDGGKSFSNVTIPISRDNITIQSLQVHPVKDEALMFYTANNNVSFSN
VRAINKDIQSTEEQTALQGSVKRNMNVEIFVACPPERHIRITRGTTCTESEDYTYTIPSD
HYDSEMKGRTNLKGLQDKVVRYNVRQWGCPIRVLHNENYKPVLFLYDGSTLNERVGVDFV
VREIHGRTDFSYTATADDVGCRRAPQTWQEILANAEDPYKAWTPQNYQNCFEGSGSLSSS
SAKLPYQILNSSNGGSYIQWGTPAEMAVFNVPSIVISKENESGDDDPPEPLITISSSNKK
VGVHEESPNQQSVEHSESLKTKDDTAKEHQVEHEPVPISSALPKETLDEIVEEALSIVIE
TRQKYKHHLGSNHPLTIKAMKKANDICAQQQKEPMYDIKE
Download sequence
Identical sequences Aqu1.223273|PACid:15721801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]