SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.224534|PACid:15723062 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.224534|PACid:15723062
Domain Number 1 Region: 5-151
Classification Level Classification E-value
Superfamily EF-hand 2.77e-56
Family Calmodulin-like 0.0000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.224534|PACid:15723062
Sequence length 153
Sequence
MSTAKSPDQFTEEQVAEFKEAFSLFDKDGDGAITTKELGTVMRSLGQKPTEAELKDILNE
IDIDGNGTIDFPEFLTMMAQRSNSDTRDEIKEAFRVFDKDGNGFISSEELRQVMTNLGEN
LTDEEVDDMIREADLDGDGQVNYEEFVKMMTNK
Download sequence
Identical sequences Aqu1.224534|PACid:15723062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]