SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.225933|PACid:15724461 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.225933|PACid:15724461
Domain Number 1 Region: 2753-2914
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000072
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 2 Region: 1106-1179
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000216
Family Type I dockerin domain 0.0086
Further Details:      
 
Weak hits

Sequence:  Aqu1.225933|PACid:15724461
Domain Number - Region: 963-1056
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000329
Family Cellulose-binding domain family III 0.0097
Further Details:      
 
Domain Number - Region: 2341-2452
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00209
Family Cellulose-binding domain family III 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.225933|PACid:15724461
Sequence length 3025
Sequence
MYNFSFGLFGIKLAGEDASSITVQIGNFSVQESFTQSLQTIKSITGALSTHSLWPDQPLL
TVLVQARDMFDNTLVGTFSPLIITAEHSTLGLMEFYECESLPVVSSGTCTAMIGIDDDWF
ISNEISFVTFTIEINETIFTIGSVELHSPPSISLTNSLYIQLPQTPLMPGGSASLFIKSS
YNYSIFGFNIDCRLEGGGEGENAAFISPRSPQEYSLLYEYYQDQRDRIALSGFRNRNQFS
TALVNRTLGDQTLVTFNLSNISENYDISCYSKGLSLTTRLVLVPVQASTRLPVLMISRDG
NASEVGEILHQEKRVAAILPYAHHNTFLNIATVNGSRQDLGAIKAIALYNDGTFDETSSL
ACTSLDKDAIQVESDCSNIYFNGSETDGIDANITVRHAALNDYSSLLVRVWILRQNTIAI
SLKDSVLNATGTCNNSTFYQTSEVSLQGIIRHNAQMHTVVVTPVLKHLLTTVNASIAIVD
DTRVVGQSPGTTGLCLGSSCTNVTVSNEFASPLYLSLFPFSSLTINLDSLSIDPEQAQIG
LISVGQEFHYRSQPVFINTLLVYEDDSAIDIDTSSELYLSVSDNQIYDRLYFIQDGDDET
MPVIGGTWSQCSETVSGSVAINISLYSPLSILIDAITLTMAPRNDPLVVLGYAQSDSLLT
LIAEYEDPDYDGPITSNATYNVTVNDTSVLTFSTDANGSITLYPVQQGYAIVQVYVFEYD
LSSSINVTVLESEPQIRFLLNTNSSEMPVNTIQHIANTQHYQEVRAEAILNIFLTNTTQI
VTNAIFTSGNDSILQLNGNTVSVNGVLSIDQNVNITATLNGGESNITAIASLGISTDSCD
VTGVQIDFPNEFIDFPGMERIANCRVMLCNGSLIEKAFNSQTGDPLYGNEFVSIGISDSN
AAIVMNNTSIIKLVGTAVEPVSVYCTSGNFRNTVSVIFNTLPNEGEVDLGTNDGLPFTTT
DESEVMIPVTIGAGVYKIGAVEINIQYDPETALFLTASQGMDWSNGSLSVAEVSTNSLRL
GGVLNNGVRDSTLHLANVYFKMLEGASNNVTILRATPVLLAVGNLSLTNVTPGNPQANTL
SVTLPNSRSRRDLRRAKRQVSTSCPPYPVGDINADCCVDQRDVYYFQEYNLASIHNFTGS
EEASLINQTIEDNGIVVDVDGDGFVTLDDIVTVEQVSSGLVYNMSASYDLSCDCSFVINI
SISTVNGLQVETESLHVFVHLAHNQSQFIEQVNDIQFSYGSLHQVFEDNNGLYTAVLRAN
LSTSGDTTALYQVRGVSSFSVPDVGLSFIQAVADNNGEISKSRVSGLFGSTPLSGDREGP
FIIDINATDSQIISLTLDDLMPHIIINPTCINIPPTTLPSLPLLLQVNRDEYFVGNVTQL
NQTYYEGRVLILSNNGSSMGGSVTASVESLQTSLSVSRSLSQVNSLRHPIASFDEYSKIL
TTTIQAFNNIDYAFNIQSSTINISIVTQSNDAIANTLCIPNSESGVCQSSFNLSSYDFSQ
LTVTFSLIGNEGNVVESSMVTVNVSSKLSFQGDGVSILLPSYTLKPGSSFDIEVYSNTTY
PLISFLFNFTLSARISLTSTHSPDKLWGVYCTQSLSCVGYRTNFQSLSVSQLSSPEHLFT
ASLYIPEDYTESSVKVSASIREMNNLFYQPVSFTGIMIVNASGSGHLNEATVSIDPSNDL
IALYAHAPQTELVNTAVLNEGLVTIPISVSGLYENNTIASISGYSCQLSDSEVSLHINSD
CSAVFVNGSETKGADNVILTITLESVTTSIGFKVWFPSLPAQLQLGSNVLKAIDGAIDAT
SCGAQLYQSTTITAISNLTTGTESLINVDLSQYVLNRIRFTPAGSIELNETSRMIQGISP
ATVTLYPTLNGLFDNVTFQVSQERVSIHYLYTIILSSISLRVSDDSSSSGEYNFYLSLSS
SFQYVNDTGVSVTLAVFSDGSTMPVTDLVSVSSSNKDILYSTDNELFTAVSNGSTTISTE
WYNPSPANCTPTVSCLRTSYDDVSLSLSLPTELIVMASSVQLTACEAIAQLLPSIPLQVE
LYALLVYPNGDEVNVTEYVSINDTVRGGDDDSVIALNANTLNNQSTTLLFSYTGSGVTLM
KTISIEVVSINTFASNLSLLSVPGNNPITTFNSIEGTNIYQQAQLVGNIAFSNGMVMSLS
NLPSSMYSINQSSDAISINNMSVIIQSPPNTQTNVTINLMLIGCNDVVASIEVTINPPTD
NNNVISVNSVSITTPLIGREGDAVELDVSLNLNGGVIYSLRDFASNARANITDIVSFTTT
ANEYIRITPSTATCILYRQSSCSNVTITIAITSGTFSNDVSASVVILPGSLEIGLKGPVS
TINTNRLISLPLSLNTHTYTVSGIEGSLMYNSSLLQVVNVTVEDTQWPGGVMFYNTESIN
DRSVLIFSGLAFNGGVTGDNVHFANVNLMTKSEGSTELYAYLTNLIQYESNSIPINELVS
TSSRITLSISDNDVCNEPNYQSNPLPITSNCSSNTLQLASGESSITCPVSLNTTTETLYS
LLQTSGDSSVDVNLNGVSDLLDPLYVTQVSTGLLYLLNTYPVLANSTRDANGNYCNVTIS
SKLIGRDGRPPTDSSLYYLLNIQSSYSFDQLFNASLISSNDSNVLLIPSTYDEETGEFTS
SLSTMLTEIPGGTVSVSLIQSTQVDGSEYSPARVLLMNKRDGTTMIQESLSINTADIIVR
QNPPYAPLVTFNDDIICPPLPLPPTLFEVFFDVEPSSRSFSFRIEESSDFGSIFLYNCSL
IENVTCLMSFRNHTNFNVSDSFNISGTRYINVTVAGLKPYTNYTFYLLNTNNQTITLNET
ITTAEAQPEGFNSLMVLDRGPTSITIKWELPTEPNGLLERTEVLTNSMTEGARRKRELSG
LKMLLVEETQYIITNLSIATVYNITVRISNSVDSVSQTISANTTFPEANFSTSVVQQMDG
CVNLTTEWIYDPVEYDISLHCTADGMTSNTVNTSLLDNGINDIVICSDGVENGTGLNTTF
ECMDSYTVTFTFMRLVVINIDIETY
Download sequence
Identical sequences Aqu1.225933|PACid:15724461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]