SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.227099|PACid:15725627 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.227099|PACid:15725627
Domain Number 1 Region: 179-516
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-43
Family Ankyrin repeat 0.0002
Further Details:      
 
Weak hits

Sequence:  Aqu1.227099|PACid:15725627
Domain Number - Region: 587-628
Classification Level Classification E-value
Superfamily SOCS box-like 0.00405
Family SOCS box-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.227099|PACid:15725627
Sequence length 635
Sequence
MGVETSRVVSPEEDTIDAYIDRDGGYLVNRHRKTATMTTVDIGLSQEKEDYNENRPPDPN
SFCNFQETTLLQFQSLIVSSRNDQQLALTLEKKLKLNSSFVEGALRRAVVSRKLDLMTHA
LEVNRLIPQDSLFKVSDGFLLQLIHRTVSLKEIELLRSLLSYISLSLETKRELQNIAILA
AQCDFLDAVQLLCSKFPSCLEQTFQGHSLLITMASQRADSSVQFMSYLLENGVDVNTQEP
SGDTALHVAIRENNIEGIKVLLEQNVCLYLKNSQGLTPLELAQGQVNALLSSCSSPQPHE
VSLYAAAKEGKRESVQQLLNSGVSINSKWVNGHTALCAASMNGDADLTHFLLAQGAAIFP
PGNTWPELPVVHALTNNHTDIACLLIESVANEYEKLNKKEKEHIHTQLVSLLHYSARINA
VAIATLILRSKFHIDLNSSFISGLSPLHEACRCGHLDMVKLLLLYGVEANLLSNFYLNSP
LHYASFYGHTHVAAYLLKYPEVDIDIENKQHESPLYCVLHGQLTAEEKSYPKESSIIFLL
LRGAKLLKPGRKNCELSQFDLLYAQQRWDFIPLQTQKLIIVVRNEIRPHSLMNAARFCIR
SSLNVPVNDDILDKIGLPYRMRNYVLLKDWFPNDY
Download sequence
Identical sequences A0A1X7VL49
XP_011409942.1.10788 Aqu1.227099|PACid:15725627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]