SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.229252|PACid:15727780 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.229252|PACid:15727780
Domain Number 1 Region: 18-181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000237
Family SPRY domain 0.028
Further Details:      
 
Domain Number 2 Region: 192-239
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000759
Family SOCS box-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.229252|PACid:15727780
Sequence length 246
Sequence
MSSEVEVSTKSGFKLPEVVCFGYHKHYRSDQMRVTDDGKEAKKVDPEVIYAKGVVYSERP
VKGRAEFEVEVISYGTSWSGNLKLGVMRHKSDKELNPLKIPRYTPESPEHCVWCASKLHD
HVTSMTEVAYGEITLDDLKEGDKLGIVITEKGVLSFLVNGKPQGTATHNIYKTGHDVYIV
VDHYANCKATRITRAIMRVDPTLQELCLDKIASCLERKEQIDTLPLPSHFRLILQDYNYP
GKDFST
Download sequence
Identical sequences A0A1X7VTY8
Aqu1.229252|PACid:15727780 XP_019852676.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]