SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.229888|PACid:15728416 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.229888|PACid:15728416
Domain Number 1 Region: 150-267
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-25
Family SH2 domain 0.00032
Further Details:      
 
Domain Number 2 Region: 273-309
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000109
Family SOCS box-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.229888|PACid:15728416
Sequence length 310
Sequence
MATDDHYSSSHSSSSSHPIPWGLPVQEDSPGTDDESVDSGLDPRGGETSSDSSPRNQKLC
SIYDEVSVQRAFGPAMKDIGRWFSQRQYLSLSEAAENDRLGSRPPLPLPPSPSRHDNNAH
NNDTNPTPLELYGKVQPRLLGSNGLELGLRDLAQYGWYWGPMTRLEAEERLTGSSDGTFL
VRDSSDDRYLLSLSFRSQGKTLHTRIEFCNGHFSFYSFPDSENEGYTSVAELIQRSMQYS
SVGVFCFSRARTMGSPAVPVRLLKPLSRFSQLRSLQHYCRFVIRQAIRFDSIRHLPLPRH
VHTFLEQSQF
Download sequence
Identical sequences A0A1X7VUN7
Aqu1.229888|PACid:15728416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]