SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.209265|PACid:15707793 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.209265|PACid:15707793
Domain Number 1 Region: 413-842
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.67e-135
Family Reverse transcriptase 0.0000445
Further Details:      
 
Domain Number 2 Region: 1014-1166
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.73e-36
Family Retroviral integrase, catalytic domain 0.0051
Further Details:      
 
Domain Number 3 Region: 292-387
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000146
Family Retroviral protease (retropepsin) 0.03
Further Details:      
 
Domain Number 4 Region: 201-245
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000471
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.209265|PACid:15707793
Sequence length 1302
Sequence
MAVASSALEPFDAKRHSFPKYVQRIKLYFEANSIPAGKQKSVFLSALGYDTFEVLSNMVS
AEELNSKSLDDLVTLLTNHFHPKASLVAERYKFGCRRQGDSETITDYVADLRRLAQRCNF
KEATLDETLRDRFICGLAQEYIRSRLLTEPDDLKFNKAVDLATMMEEARRSAQLMQERSS
TKAAESHDVHQTNMRDTRKSITQTQEHVICYRCGGAHFAHKCRFIKEKCRACGKIGHIAR
VCRSKTAGKGPAREPFKRDVRTNAIDDNATDEESEEESYPVYTLPSSKVAPIKVQIVANG
HNMEMELDTGAAVSLISESTFNRIFKGEVELKPSSVVLRSYSGHKLDVLGVIDLVITHNT
QTASLPLVVVAGDGPSLLGRNWLHLLKLDWGAIKNIQSKSALAELIKKHTPLFRSQLGKL
KGATAKIYVPSDAKPRFFKPRPISYALKEKVEKELERLQQEGVIIPVTFSDWATPIVPIV
KPDGSVRLCGDYKVTVNAVAKLETYPLPKIEELFTALSGGTIFSKLDLSHAYQQIMVHED
SCKYTTINTSKGLFQYQRLPFGIASAPAIFQRTMETLLHDISGVVVYIDDILVSGKDETS
HLQNLDLVMERLEQAGLTLKQSKCTYAVSSVEYLGHIIDKDGLHPSPSKVEAIRSAPEPR
NTTELKSFLGLLNYYSRFLPNLAIVLSPLYRLLQKKTKWSWLDIEKKAFQKAKSLLQSSN
LLVHYDGRKELVVSCDASPYGLGAVLAHKMQDDLERPIAFTSRTLSPPERNYSQLEKEGL
AVIYAVKKFHHYLSGRKFTIYSDHKPLKYLFSETQQTPRMAAARIQRWALILGSYQYTIQ
YRQGNKMSNADALSRLPLPCLDKDKSTEKDGSVLLLLNHLSEAIVTSSQIRSWTEKDPVL
SQVLHSIRHGWRLNDSNSNSLKPYIDRQNELSSVDGCVLWGSRVVIPPQGRSIVLKQLHN
THPGTNRMKGLARSYVWWPGLDRDITELVKHCSICQAHRSSPPRAVLHPWEWPNRPWARV
HIDHAGPFHGKQFLIVVDAHSKWIDVQQVSSTSAEATIEALRFLFATHGVPEQLVSDNGS
GFRSSEFQMFTSQNGIKHIFTSPYHPASNGLAERAVQTFKSTVTKMEGPMDQRIARFLLQ
YRITPQTTTGLSPSQLLMGRQLRTVLDLLYPDTEQTVRSKQEKAVGGRVHTRRFKIGDLA
YTKTPQEKVWLPVKITKVTGPLSYQVITEGGVVMRRHIDHLRSRFEEQTSHHSDVTDWSF
MGSSQEVEQEEQRPSVPPRSGPLRRSTRVPRPVDTYAPLVNT
Download sequence
Identical sequences Aqu1.209265|PACid:15707793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]