SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.211317|PACid:15709845 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.211317|PACid:15709845
Domain Number 1 Region: 396-831
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.11e-126
Family Reverse transcriptase 0.00015
Further Details:      
 
Domain Number 2 Region: 999-1154
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-37
Family Retroviral integrase, catalytic domain 0.0054
Further Details:      
 
Domain Number 3 Region: 278-372
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000045
Family Retroviral protease (retropepsin) 0.027
Further Details:      
 
Domain Number 4 Region: 191-236
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000449
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.211317|PACid:15709845
Sequence length 1323
Sequence
MAENTPYGRLEEFSPEIETFASYSERVELFLQAHAVPDDRQVAVVLNAVGVKNYSLLRGL
VAPAKPSEKTVTELLDLLKGHYEPEPVIIAERYHFYTRNQKEEESVAQYAAELRRLASTC
SFGDHLDDALRDRLVCGILSAGARKKLLAEKKLKFQGAVAIATNYETIEKDSRSIQQQHE
SGDAHKVAYKGKDTGDKPCYRCGRQGHAPSTCRFRNARCNNCSKLGHIAAVCRSNQGKKY
NRSQGKTHKVDEQADETSGESEDDLGVFQIQSISSHSPPIMISLKLNGQTIEMELDTGAS
VSLISEEVKDKYLPHVPLQPTHIRLQTYTAQSIKVLGKCQVTVKYGVQEKSLVVIVVAGK
RPCLFGRNWLKHIVLDWSSISHVSLAEKQKVDKVCSKYGAVFREETGIMKNFKAKLQLKK
DAIPRFHRPRQVPFALKEAVGQELDRLEGCGILEKVKTSEWAAPIVAVPKKDGRIRVCGD
YKVTINPFLDIDVYPLPNVDEMFAVMAGGEKFTKLDLTNAYQQMELDNLSRDLVTINTHQ
GLYRYTRLPFGVASAPAVFQRTMDTILQGLDKVVCYIDDILLTGVDDNDHLKTLEAVLQR
LQQHGITLKKGKCTFLSKSVEFLGYRIDGQGLHTTPDKLCAILKAPYPTNVGELRSFLGL
LNYYNRFISNLASTLHPLHNLLKKHNKWLWTEACSYAVDEARRKLVSSDLLVHFTSSLPI
KLDTDASAYGVGAVLSHICKDGKERPIAFASRTLSKSERNYSQLEKEALAIIFGIKKFHK
YLYGKHFVLVTDHKPLTTILSPGNAVPTLAAARLQRWALLLSAYSYSIGYRSTEQHGNAD
SLSRLPLPHCPKRELDVDTLFNIIHMSSLPLTHSKLKAATLTDPKLSKIMGFIRTGWPQT
VDEELAAYWRRRNELSVEIGCLLWGRRVIIPRKLQKQVLLELHTGHPGICRMKSLARSHL
WWPNLDADIEQLARSCRPCLEVKSTMTPPPLHPWIWPRKPWTRVHLDFAGPLYGKMYLLA
VDACSKWPEVWEMSSTTAKRTVQILSHLFGLYGLPEQIVTDNGPQFVSEEFCSFLRERGV
KHFRSAPYHPATNGAVERFVKTFKQALKIGRQEGKLSSQEVIDRFLLQYRSTPHATTLST
PAELFLGRLLRTRLDLMKPEIYQEVERQQAHQKHYFDRRGCDRVFTLGQNVLVREYCRGG
VKWSFGQITGICGPLSYWIKLEDGRQVRRHVEQLKKGSARDRVDKDINDDWMSHTTEPQI
EESPDLRDETGYHGNEDQGSEGMAEDQLERQEVDTPSETTSPVPRYPRRNRRVPERPFMV
SLS
Download sequence
Identical sequences Aqu1.211317|PACid:15709845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]