SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.214030|PACid:15712558 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.214030|PACid:15712558
Domain Number 1 Region: 23-134
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-33
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000843
Further Details:      
 
Domain Number 2 Region: 196-265,300-335
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000000602
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.214030|PACid:15712558
Sequence length 434
Sequence
MSTNAASQNEPSILLSNEENQLIFTIVGSRKVTRATAVVQMYHAHPNPNKWEKFSTGVAC
FVKDNSQRSYFIRLIDLKRRAVVFEQELYDEFRYSKDRPYFHSFPGHEFMVGLNFASEEE
AEKFRAAVESKITYARRATMKRKPPSEPKKPVNTVAPGPVANKDPYSLGVDGSDKGKLNK
PKGGKKLTKADIGLPTEFRHLAHVGWDPQTGAFNSSNIKPEWKNLLDSVGVTEEQLKDKE
TADFIYDFVEKHGGIEKATRQLEASKTAKAPNPPSHRGHAPPPPPPSRGNRGPPPPPPRG
AAPPPPPPPPSGGAPPPPPPPPPPPAVGAPPPPPPPASGRGGPPPPPPSSKPSASSNLPV
IDDARGNLLSSIRAGITLRSVAHTEPEESKSPDEEVGGMAGALARALEMRSNAIHGDSDN
SDGEFEDDDEEDWD
Download sequence
Identical sequences Aqu1.214030|PACid:15712558 XP_019856526.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]