SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.214107|PACid:15712635 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.214107|PACid:15712635
Domain Number 1 Region: 137-238
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-18
Family Second domain of FERM 0.0012
Further Details:      
 
Weak hits

Sequence:  Aqu1.214107|PACid:15712635
Domain Number - Region: 51-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000599
Family First domain of FERM 0.037
Further Details:      
 
Domain Number - Region: 237-288
Classification Level Classification E-value
Superfamily PH domain-like 0.00369
Family Third domain of FERM 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.214107|PACid:15712635
Sequence length 298
Sequence
MSHLEGTASTYTTRLCSSPKKSFAGDAHTVKMAWLTNFFRRRRHRAITRQYHVVLQDGTE
RTFELQRTATVQDLVEVSLLSMSVPAPYHYMFSLTVTNSSQQNPRWLRLRKTLKKELKNT
EPQTKLYVTVLMYPKSHFVLEHKVVRHLLYAQVCKDLNDGRIKCTSDVMAQLTGLIAQAQ
LGDYSERTLQSDYMSRLNVKMSPKHERMAVEQHKLRRGLQTDSCIEEFLNMAEGLNGYGS
ILFDLQDEQSHPVVLGCGPNGIEVLEGNIQTLSIKWETVTIINIRYRTINFHSDTTYE
Download sequence
Identical sequences Aqu1.214107|PACid:15712635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]