SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.218259|PACid:15716787 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.218259|PACid:15716787
Domain Number 1 Region: 21-181
Classification Level Classification E-value
Superfamily RUN domain-like 5.89e-25
Family RUN domain 0.00089
Further Details:      
 
Weak hits

Sequence:  Aqu1.218259|PACid:15716787
Domain Number - Region: 206-270
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000685
Family HtrA-like serine proteases 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.218259|PACid:15716787
Sequence length 345
Sequence
MAAVESSSSEVIVKISSISHPLLEEMKGILSRLKMVGGMIQDGCPHLVPFCETIESVFRH
GLKQPNSFFGLNRQDYWSWIEMLQEYYFNEKQNPLLHSLVTDISSTNRIRTLQGRGRCFI
RGSLTNKLISVPVEHLVKNTKLTEYWYVKDSIIASTELRAVFMELLFQATEVDFDLDYKT
SGFLNETWVIPVYVTYKLPPVKTLDIGVRRIDERQLVVDIEKDCLAYKAGIEVWDIVEEL
CGQPIHLITGNFQKYVAKHSIDFTEITVVKQSLEQLEKIYLGKHIMLINEEEVGQKTIDT
AVSRVLHDTRKPEDITLTLSTVGLLLLLKEVSLFHSIHIILSLSL
Download sequence
Identical sequences Aqu1.218259|PACid:15716787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]