SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.218970|PACid:15717498 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.218970|PACid:15717498
Domain Number 1 Region: 196-268
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000327
Family Second domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.218970|PACid:15717498
Sequence length 540
Sequence
MAAVLEGIQQETTIEVLPEDSHPSTDGPPQELAPTKEEGDEEEAKTPTRGVKFSIADVIE
GLPSTDSDQSQSKLMAPVKPITLRIYTCLEEQVSIQFSTGKFTTAGEIVSAMVSQLNLPE
ETKNVFSVWMISQHLHLQLKSYHVPVKLFKKWNDFLTQYTTASYEVCSTDKPILSFRRNA
FFSLREEKRLIAKKNSKEVITLLYHEARLNVISGRYPLSKEELIELASIQCAIENKEYNK
EQHTPQSFKSSLSQYFPPHLVPATGGVKNKLLGKGSKSTGIENDLVTKYESIWLKVSSES
KKRIDASVDVETSAVANSLGTEEEKKQWLDIDLQLKLLYLQRCWIKPYYGCVMFRGQIER
KQILSLSDRNVVVAINPECIHLFTDTQPREILLYLSYDMFCWEFQPATEQGENFYSSLWL
EFDSFHASQKVAKRVQVFSRQAPMMDAMISRCVDELNQFDEEVKKKRLEKGGPEELPPVS
ITTDKALPSSKNFREDVLKCDMYTPDGEQVNQISLFRKKKVSTTAAPSAANPGNEEVTGL
Download sequence
Identical sequences Aqu1.218970|PACid:15717498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]