SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.221609|PACid:15720137 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.221609|PACid:15720137
Domain Number 1 Region: 156-467
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-94
Family Protein kinases, catalytic subunit 0.000000000693
Further Details:      
 
Domain Number 2 Region: 13-134
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-18
Family Pleckstrin-homology domain (PH domain) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.221609|PACid:15720137
Sequence length 490
Sequence
MAEKGAPPKESGDRLIVKEGWLQKRGEYIKNWRPRWFILYSDGSFVGFKAKPAAADLALQ
DPLNNFRINANVQQLKQDKIKKNAFSVRCLQFTTFVERNLCTETEAERTEWMSAIDQVVK
TLKDAQRKEDSRVQNTEDANTSPKSPSESVKATQKTMEDFEMLKVLGKGTFGKVVLCREK
STDEIFAMKILKKDVIVAKDEITHTLTENRVLQSTKHPFLTQLKYSFQTADRLCFVMEYV
NGGELFFHLSRERVFTEDRTRFYGSEITLAIEYLHSLGVVYRDLKLENLLLDRDGHIKLT
DFGLCKEEISYGATTRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYS
RDHEVLFELILVEEVKFPARLSHLAKSLLGGLLTKLPEKRLGGGPDGAESIKKHPFFGSI
NWDDLFQRKVSVPFKPTITNEVDTQYFDEDFTKEEPKLTPPDADDPQAGVGENVHFQDFT
FAPESGSNFK
Download sequence
Identical sequences Aqu1.221609|PACid:15720137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]