SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.221610|PACid:15720138 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.221610|PACid:15720138
Domain Number 1 Region: 148-463
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-95
Family Protein kinases, catalytic subunit 0.00000000125
Further Details:      
 
Domain Number 2 Region: 6-118
Classification Level Classification E-value
Superfamily PH domain-like 9.65e-21
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.221610|PACid:15720138
Sequence length 481
Sequence
MAGREVTVVKEGWLQKRGEYIKNWRPRWFILYSDGSFRGFKNKPEDKFKSDQDPLNNFRI
DADAHVIIATDKSKKFGFIVRCLQITTLIERNLATDTETERVEWISAIKKVISYLKKAQV
EEFDHLSPKTAEALAFASKTHQKPSLKTMEDFEMLKVLGKGTFGKVVLCREKSTDEIFAM
KILKKDVIVAKDEITHTLTENRVLQSTKHPFLTQLKYSFQTADRLCFVMEYVNGGELFFH
LSVEKMLTEERTRFYGAEITLAIGYLHSLGVVYRDLKLENLLLDRDGHIKLTDFGLCKEE
ISYGATTRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYSRDHEVLFE
LILVEEVKFPSRLSTLAKDLLDRLLTKAPERRLGGGPDGVEEVKAHPFFSVINWDDLYNK
KITPSFVPNIKSEIDTKYFAPEFTGEEPKLTPPDADDPDAGVGNLHFQDFSFVPEAGSNL
Q
Download sequence
Identical sequences A0A1X7UYV0
Aqu1.221610|PACid:15720138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]