SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.223711|PACid:15722239 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.223711|PACid:15722239
Domain Number 1 Region: 19-139
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.39e-16
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 139-180
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000955
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.223711|PACid:15722239
Sequence length 310
Sequence
MADQLWFYVVNQQENELKQFLKDNKGTFDINRRDASGRTLLDYCCPTVGYISTTVYSETT
KYSAYIRIAKDLLDNGSDPNSADQRGWTIIHQCAIVGDLTLLSLCMLYGANSSLYNHGGQ
LPVDLAYLKKHDHIVEYLEKHSLSLKQLCRVTIRDAMGPRTYNRINELPLPPSQKLFINY
GNPFVGWVGTLYVPRPWTDDDIRSGRVDKGDVLAFFVTNASSEFMEEKEIEDKWQNLTFS
DLAELFESLYFWESFKTIDYEEPLARKPRYALEKLTLRDEEEEGERGRERNRRERESSEF
NFSRIFRRRN
Download sequence
Identical sequences A0A1X7V6S2
Aqu1.223711|PACid:15722239 XP_019850368.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]