SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.224922|PACid:15723450 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.224922|PACid:15723450
Domain Number 1 Region: 3-154
Classification Level Classification E-value
Superfamily RUN domain-like 3.92e-33
Family RUN domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.224922|PACid:15723450
Sequence length 308
Sequence
MTQVCKMCVKSLVDKSPFETITDDCPHLNNLCNVLEHIFLHRMQARWSIFSTTDPVHYWH
IIQQYASSVTVGSIDDMENVSTELGKCRAWLRLSLVQKRLATFMDILVSKQHELKVAYMQ
GALMISAELQEVAGVLKCLDAIDFNLCLRDQDFDYYDKLEIDYSPYLVFHQNTSSRRDDR
QEERRLLSTSSSIDSRGIDEEREEEKEEEEEVTSLKELLKVEREQKNYYEELVSVRDTQI
NQLQRELDSLGRESEKEKKEMSGIIIELQDQISKLQDSIRQQQKAGRRTNDNRRSGLFSS
IFKSGDED
Download sequence
Identical sequences Aqu1.224922|PACid:15723450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]