SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.226505|PACid:15725033 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.226505|PACid:15725033
Domain Number 1 Region: 351-462
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000085
Family Second domain of FERM 0.0073
Further Details:      
 
Weak hits

Sequence:  Aqu1.226505|PACid:15725033
Domain Number - Region: 177-225
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0448
Family First domain of FERM 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.226505|PACid:15725033
Sequence length 715
Sequence
MAVSFRLTREDSPTSFFNSWIFSPSIILSAGLCLVTSKRPVGDACLRIKEELVCRCGSNP
ATPCREQRAPPSVSLFDFLQFLSFGVGAIIAMSFRLTVEYEPDRSPGDDTASFIMEISRM
SKLSEISHSIYKHIESNLRQPEDQYALYWTENKMWLTADRPIGRLLRGVRSASVQYRRRL
NPYKLRFLDASSKIVILDESQPVKDLVNSICKQLTLGHPEEVSLVVAVDYAITKHHPAVK
QDIAKSPIIAGRKDLTLHTSLSDTSSSSLSPKARRKFVRPASADVTQPVSGSERPGSGKL
RRKSQIVAISKKKQLSKKYQIRIDTPWLDPSKTLTEQEVSPQDELILMYRYYYHMDLEKE
SKETEMLYKQARAMFLAGEMMSSSELIPKFIALLCQITKGDFVSKEETQDILTKLKRLLV
PPKYKPKNIAKDVSLYYKLLKGLSANDGKCWFIKLWSTCHLFGMEFFSCSNTEIKEKGLV
GISKEKILFLHSNNKKKNKDWDMSSLTHWEQDEIGDIVTLFFGDERLKVQVQDYSSVLVD
CLKGHQELRESFPPALYQLGQQEYQFSDAGSLSSEFKKYFNIAETKRGHKRAGSLTYSEV
CFADKITENPLVSPEEEEVLQKEEMWENPAFENLDQLMEERFSFLDFDEDVTEEQPPGSD
SPLDGIKLEVPPKVTIRTAGSTGGAPHHYPSPLLRASTSSTKQRTSSGSSSSDDS
Download sequence
Identical sequences Aqu1.226505|PACid:15725033 XP_019848741.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]