SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.226581|PACid:15725109 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.226581|PACid:15725109
Domain Number 1 Region: 497-528
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000263
Family Ovomucoid domain III-like 0.014
Further Details:      
 
Domain Number 2 Region: 536-566
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000208
Family Ovomucoid domain III-like 0.014
Further Details:      
 
Weak hits

Sequence:  Aqu1.226581|PACid:15725109
Domain Number - Region: 209-251
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000259
Family Thyroglobulin type-1 domain 0.004
Further Details:      
 
Domain Number - Region: 370-401
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000471
Family Ovomucoid domain III-like 0.027
Further Details:      
 
Domain Number - Region: 333-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0477
Family Cripto EGF-like domain-like 0.049
Further Details:      
 
Domain Number - Region: 84-125
Classification Level Classification E-value
Superfamily ARM repeat 0.095
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.226581|PACid:15725109
Sequence length 774
Sequence
MPKAAFALAFFLTVIALQLADANRFGNVRVVSCERARRFYEYISXTTGPNAPTRCGSDEE
YVRRGYGWGTCRPKLSGNDTCVREEEDDDDDDDVYDDDDDDDDDDDDDDDDDDDDDDDDD
FVSDDIPVAQLELASSMEEDMMEKDEDDRVSRIVTGSSSRRASRKINRYINQCSDGYYCR
KVRDDSRGRCEQQNTDGVCYRNSNNASGECDSNGYYKPRYCRVVTVNNRRRIICVCVIPS
NGTRLADTRTTFEDTGNEEENENRKPKCSERVYGTCRVTRGGRRFSMKHGERDTNPCMCR
TCVCYFGTLYCRTRRNCRRCDSTKTCTLPNDTVIRHGQSARVDCNRCSCRYGNLYCTDRD
CNTTATTDTNCTRCRSEGVSRVCGPNGKTYINSCTAIYCAGIASVDLIDGPCPRTNPCIR
FPCDPGQVCLKRGGVSCLARNTGCRPDTLRHCINVTDLSCTNETAVSDDDDDDDDDDDSD
TDGDGIGNGDVDPDDTSICGTDGNTYASICHMVQSTVNVTILHAGHCNALRCKGGRVCGT
DGVTYENICELRTQSNNARFDYRGACVDDSDETPDGVCERVISSGRCRFNTSNCPCLVRP
TVGCCPVCGGAILALLDIEGISNASSLDPDLETLDGYVRQIVSDELFLNVTAGRCSVESS
LTTAGNIELAISSMSNRSNDRCYCHRVATNITIAINRSVEEQSRKRRQATTNTDTSLSPS
YQYILGASEAQLETSTGGPGTEGTGTTATPTSSGVTATFAFMTVLLLTVLAIVI
Download sequence
Identical sequences A0A1X7VHQ1
Aqu1.226581|PACid:15725109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]