SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.227471|PACid:15725999 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.227471|PACid:15725999
Domain Number 1 Region: 372-500,817-997
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.46e-43
Family Diacylglycerol kinase-like 0.025
Further Details:      
 
Domain Number 2 Region: 100-210
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-17
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 282-342
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000108
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00028
Further Details:      
 
Domain Number 4 Region: 1221-1290
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000101
Family SAM (sterile alpha motif) domain 0.08
Further Details:      
 
Domain Number 5 Region: 209-267
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000613
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.227471|PACid:15725999
Sequence length 1300
Sequence
MEDLQPEDDSNLKGNLVTRRIITRATTCPTRVTTCPAILDSEDESYCSEEEHDDSRKMED
EMLMSMKMGIERELAEDEDRHHRRISLHHSHSPSSSSSTFVPQVTIYKQGHLLRQTKTLG
RLVKRYCSVENHKMFMTKKKEDKLREEVLLKDATLVENSTQNVNNSFTIMTPHQNVILVA
NSRKEMEEWLTAIKQSVQRANNAEILDSFHHLDGQHSWFSCSHPRPVYCNVCGEALGRVT
FKGLSCEVCKFKCHRHCVFSVNQKCKWATRTNLESDGVKVSQDLSFPHQWMEGNLPSGSK
CSVCKRACGSLIRLQDFRCLWCKGTVHADCKDSVTTPCTLGSLNLSTLPPSAIQQSNDIV
KGMWEPLKLPSHDPVLAFVNSKSGDNKGVRFLRRLKYWLNPLQVFDLAISGPESGFNKFR
VLVFGGDGSIGWVLSTIDKLHLHSKCMVGVVPLGTGNDLARVLGWGGQCSDEEKIPTLLN
EMECSSYRLLDRWSVWFTTDTSVDAHDLVKNFQRSRSVGSVDSKSQILVSPDDPSRSFSS
PSHPACSPSTPPTLDHTHLNTLTVPLDTISTVSSGSSQYHSAHSRTSSIGTAPADEPSDD
GGESKEEKVEEEGETLHIVPDDTALTRKSRSPPKTLALSSSPKIRLKDTCSTLQSSVMSH
ISTVLLSENETDVISSAQVLCELVSQFVLSLQGQQKVNLSEDEFTNDPLMQKCSVLNDKL
RKLILTLNNDVGTPNNEERTNSNAQPKTKVFQSRDCLMARANSLKKAVQNVIDMTEKVVD
TQQEVITDLTPPQIICQPSPSARASEETEHFFSDMKELYCMNNYFGIGFDAKIAYEFHTR
REENPGQFKNRTKNKILYGYLGGREFFTNTQKNLERKLKLECDGKEIQLPQRLQGLVFLN
IPSYMSGTNFWGTEREKEGFSAPSIDDKLLEVAGVTGFMHVATAKVLGIQNQRLAQCRTA
KVTLHTQVMVQVDGEAWSQDPGVILISHKNRAKMIVKDKAFVQSLESWSQRQPVGGGGGG
PELPLTSPSVINLQEALTTDEIKKYQEINATVRPLIDCLQAESEHNADFHFDIASHIAAA
TVCLDRVFPSLDVVSDKVSESFRKFQTADLEHLQDVERTVKSLLQETLWFLNMEKISIEK
EEEIRQLVKVVEVQVKRVMIPHPLLQRTSRRASDSVLVHRTVHHDPHARSPVLTSHRERS
GHLVNAEMISASNRVIENIGKDVPDWTIDDVCHWLDGIGFSECITATCSIGCDGKQLLSM
KTEDMHALGIDKISVQTKMRQALQTLRSPKNSLSERRLTK
Download sequence
Identical sequences Aqu1.227471|PACid:15725999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]