SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.227803|PACid:15726331 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.227803|PACid:15726331
Domain Number 1 Region: 301-496
Classification Level Classification E-value
Superfamily SIS domain 0.000000000000248
Family mono-SIS domain 0.00087
Further Details:      
 
Domain Number 2 Region: 4-158
Classification Level Classification E-value
Superfamily SIS domain 0.000000004
Family mono-SIS domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.227803|PACid:15726331
Sequence length 572
Sequence
MELPITEQSNSLSSNIDIQGSDGILRILKQCDAEIFNGWKQHKSLYDFASSLENLSIMAA
KIIKNDRGIVVMSGCGTSGRLGFITARSFNQVFPGKFHYTIAGGDRALLLSTEAPEDSWT
DGVRDLEKVSTSFEEVLFIGITCGLSAPYVAGQLDYCMKHLEKFCPVLLGFNPVELARQV
SIRNWDKTFYDVATAMRSLGEPKCYIINPVIGPEPITGSSRMKSGSATKIILETLFILSA
NRVMELEPQCRASDIFLSYEILLRCTYLQSKSISRLLKAAGNTYVSILTNKHHVILLRLC
RFCTGGRVCYLGRDTEGILGVVDASECPPTYGADYDDIRGFLQKNWEYFKAEVLPLLSEK
DCVIFVGVSPNDAKDLLQLIQEKTCTIGMITTSSPENTIKDPANIISVSISVASEAIEAL
LPSSFISSSLFTNAASSRFIVSLMSGMCIKWSLNAISTGAHIAKGKVLGNKMIDLQVSNT
KLYYRSIGIIQELTGASRHVAEKYLLLSIYGSDTELPTTDEEVLSHISAATGKPLIVPTA
ILMIRKSDLSVEGAREWLRNQPVLRKGLNNEL
Download sequence
Identical sequences Aqu1.227803|PACid:15726331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]