SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.228752|PACid:15727280 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.228752|PACid:15727280
Domain Number 1 Region: 302-416
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-26
Family Phosphotyrosine-binding domain (PTB) 0.0044
Further Details:      
 
Domain Number 2 Region: 89-183
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000177
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Weak hits

Sequence:  Aqu1.228752|PACid:15727280
Domain Number - Region: 252-257
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.228752|PACid:15727280
Sequence length 460
Sequence
MGHEILTDEVGKFLTMLNVEIQKVRSEYEQLSKSQKSIAAYLEQQSAQICIPDPDPSGTI
TNIVNWCSCYMVTDPFVEYQPANLQLQSKSGYLMYRQQGSKWERIYFYTKEHLLYWQHLN
RAAEILLDLTAAGVDASSTDIDDRRYAFQIITVQQTQQGGGMRKALYFQAESAKSRDEWI
ATFINIVNAKRKQMQSEAVGNLLEIDTRERTDSDLVRIERERVKTFVQSHSSSTLPKYPS
IPQSSPTKQLAPPPLPPRPHPQKQQKRARPPPPPPFGRGRKQSVQKLLEIADDTQAMDEA
AVASGYRKSFTVRYLGSLEVDKNQGVRVVKETIRRIVAARALKNIMAAYYVNINITHRGI
SLTEIKSGQVNHVFKMKDISYCACHPDNNKLFGFIVREWDNGKYKFICYVFESDRSGKES
ESPQTFYKVQEHQYVSEKVYQAIIDAIKYAVNMIMVSNRL
Download sequence
Identical sequences Aqu1.228752|PACid:15727280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]