SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000119544 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000119544
Domain Number 1 Region: 52-129
Classification Level Classification E-value
Superfamily Homeodomain-like 1.84e-19
Family Homeodomain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000119544
Sequence length 231
Sequence
MDWNTNLRHHVSRPEPSFGFLYNYNCYDHHPPGMEMKHQAMISETSSQGGLVPGMXDRNN
HQSSYGCSSQDKKKRLTSDQLESLERSFLEEIKLDPDRKMKLSRELGLQPRQIAVWFQNR
RARWKAKQLEHLYDALKQEYDVVSKEKHKLQEEVMKLKTILRDEVARKQVSTGYTEISGE
ETVESTSVSIRSANKARGTNQHKIAEYNYLYNVEEYNPVSPPFWGNLPSYP
Download sequence
Identical sequences MDP0000119544|PACid:22664914 XP_008350329.1.92800 XP_008387470.1.92800 MDP0000119544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]