SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000119941 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000119941
Domain Number 1 Region: 47-353
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.71e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000295
Further Details:      
 
Domain Number 2 Region: 374-496
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.41e-43
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000119941
Sequence length 497
Sequence
MAMASLARRKAYLLSRNXSNTSSEAVRYSFSLTSFSRGFASAGSDDNDVVVVGGGPGGYV
AAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKVSLFSLLLAPTVPYLPARALLHSSHM
YYEAKHAFSHHGVKFSDVEIDLPAMMSQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFIS
PSEISVDTIDGENKVVKGKNIIIATETCGGWSRIYRPRDGLGVGRLGSEVTVVEFGPDIV
PSMDSEIRKQFQRSLEKQGMKFMLKTKVVGVDTSGDGVKLTLEPASGGDQTSFEADVVLV
SAGRVPFTSGLDLDKIGVEMDKGGRILVNERFXTNVSGVYAIGDVIPGPMLAHKAEEDGV
ACVEFLAGKVGHVDYDKVPGVVYTHPEVASVGKTEEQVKASGIAYRVGKFPFMANSRAKA
IDNAEGLVKILAEKETDKILGVHIMASNAGELIHEAAIALQYDASSEDIARVCHAHPTMS
EALKEAAMATYDKPIHI
Download sequence
Identical sequences MDP0000119941 MDP0000119941|PACid:22643547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]