SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000120904 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000120904
Domain Number 1 Region: 21-70,164-238
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.93e-18
Family FAD-linked reductases, N-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000120904
Sequence length 357
Sequence
MGVSFKECVIKLHLFQELEQGTVTSLLEEKGTIKGVKFRRKGSQEFTAHAPLTIVCDGCC
SNLRRYLCNPKVDIPSCFVGLILEDCQLPYANHAHVILGDPSLVSFYPIGSREIRCLVDV
PGQQVPSISSGEMAHYLKTKVAPQVXPELYTAFLVAIDKGNIKTMPTRSMPATASHTPGA
LLMGDAVNMRHPITGGGMVVALSDVVVLRNLLRPLRNLNDVPALFKYLESFYTLRKVSSL
CLSLLAVGSNLQPAAFTINTLAGAAYKVLCASPDPARKELRQACFDYFCLGRVFSNGALA
AFSGLNYCPWSLVIQFFVVGIYAVGRLLIPFPSPKRIWIAARLILVSNSITTTTPTK
Download sequence
Identical sequences MDP0000120904|PACid:22629470 MDP0000120904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]