SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000123832 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000123832
Domain Number 1 Region: 2-163,260-373
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.45e-46
Family FAD-linked reductases, N-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000123832
Sequence length 406
Sequence
MGIAGLATAVALKRAGVEAXVLEKSDGLRATGAALTLFPNAWCALDALGVSQHLTSLYAP
IKKGYVTDIDTGEIQEVSFAASNGNDPVXPRSVNRKALLKTLADELPPNSIRFASKLTAI
ETQEHEGSSISVIHMGDGTIIKAKILIGCDGIHSVVARWLGLAEPVYSGRWAVRGLAVFP
EGHRLDYNVQQYVGLNRRAGFVPLNDKEIYWFFGTSPAKGTDLGDEPEVIRQEVIENYAK
DLPPIYLDIVQHSDLSTLSWAPLMFRYPWNVVFGNLGKQNITVAGDAMHPMTPDLGQGGC
LALEDAVVLGRYIGTSFVQNGRLVPKEIDSAIGKYVEERRWRVALLTAGSYLSGWVQHLG
PGWVRKFLRDAIFYRRASTTKRMQRNAYDRERKSPKPLPITSKGLP
Download sequence
Identical sequences MDP0000123832 MDP0000123832|PACid:22633934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]