SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000123987 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000123987
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 
Domain Number 2 Region: 337-515
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000022
Family FAD/NAD-linked reductases, N-terminal and central domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000123987
Sequence length 518
Sequence
MGKQVAIVGAGISGLLACKYTISKGFQPILFESTSSIGGVWTKTVESTKLQTPKPVYQFS
DFPWPSSVEEDFPSQHQVLDYIQSYAQHFDLLKHIKFDTKVCGIEYEGASEDEMQAWSHW
GGTGEPFSSKGKWKVAVEDKHSRSTEVYLVDFVILCIGRFSDVPNIPEFXFNKGPEAFHG
EVIHSKDYAAMDYERARNFVKGKSVTVVGFQKSALDIAMECSNTNGIEHPCTVIYKTEHW
TVPDYLPWGVPLAYLYLNRFSELLIHKPGEGILLGLLATILSPLRWGFSKFVESYITKKL
GLAKYGMVPKHSFLQEISSCLLSTIPEKFYDRVQEGSIILKKSPSSLSFDQEGILVEGEA
SPLQTDLVILATGFRGDKKLKDIFVSPTFQDYIAGSPEAILPLYRECIHGRIPQLAVIGF
SESVSNLYTSEMRCRWVAELLAGTFTLPSIKEMEKDVNKWDGFAKRYAGXYYRRSCNGTL
HIWYNDQLCKDMGWNPKRKKGLFAELFEPYGPLDYAPS
Download sequence
Identical sequences MDP0000123987 MDP0000123987|PACid:22662898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]