SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000126888 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000126888
Domain Number 1 Region: 157-217,268-280
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.89e-16
Family HI0933 N-terminal domain-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000126888
Sequence length 304
Sequence
MATTPALTLHLSRLARHFPFSSSSLPTPPLFPRARLILRPRDLPFRRTCSFSICNFSRRF
SVSASTTPGRSWKNSSSITLGAPRIAKLLGAPKSEEGKFSSNQICSQAFQXXPSLFSEAX
ITATKXPRAYQLGLPNPDKLELTNNKGLSDDGLHDERYDVIVVGGGHAGCEAAIASAHLG
AKTLLLTLNIDRIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKISDRSTDGWGSFAFFFL
SGKAFWSYNVVKGPFPNGCYLQKRVLNASRGXAVRALRAQTDKREYAMEMRKIVERQVLL
YLSA
Download sequence
Identical sequences MDP0000126888|PACid:22675379 MDP0000126888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]