SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000130370 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000130370
Domain Number 1 Region: 52-301,403-424
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.08e-26
Family FAD-linked reductases, N-terminal domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000130370
Sequence length 505
Sequence
MSLAACWRLTLTCPPPTSSRTSSCFSPRSRSGFRCRASSGQAHAAIGGPNDKEKKKVVVV
GSGWAGLGAAHHLCNQGFDVTVIEQGSGLGVLHEIGIQRGNWYPFRNIFSLVDELGIKPF
TNWTKFAQYSAEGLEIELEVLKCVNGGSNVLQAEFPNVLSPLIQVGLSAPAEQCSAAATL
GLLSYIFAHQKNFDLVLCRGTSRERIFKPWMESLTTKGCKFEKGMQLTDFVLNEETGSIS
EVVCNGGVYNADAVVLAIGISTLQKIIENSAVLCTREEFLKVLNLASIDALSVKLWLDRK
VNIPNACNACSGFDDSFGWTFFDLNAIYDDHKDSSVTVLQADFYRANELLPLKDEQIVSR
AVSYLSKYIKDFKNVTVTNKKIGRFPKSLPHFFPGSYKDMMRGATSFQNLFMAGDWIITR
HGSWSQISINKKTEDICFAAFPRQEKTYVTGLEAANRAVDYLEEGSFAKIIPVEEDEPHI
QALRSLNRSFKEITAQLPLSSYFLQ
Download sequence
Identical sequences MDP0000130370|PACid:22654204 MDP0000130370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]