SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000135231 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000135231
Domain Number 1 Region: 74-155
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000162
Family FAD-linked reductases, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000135231
Sequence length 181
Sequence
MAAASXXLSHPKPHTNDAVSSLRSHFKPSSFASXSTSFGSSKFASKXLSLRTAATRSGRP
EPATLSHSESRSDQTFDVLVIGAGIIGLTIARQFLIGSDLSVAVIDKSVPCSGATGAGQG
YIWMGHKTPGSDLWDLGLRSQKLWEELAESLIEQGLDPLQLLGWKKTGIFCVSKARSLLL
L
Download sequence
Identical sequences XP_008356684.1.92800 MDP0000135231|PACid:22629791 MDP0000135231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]