SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000136847 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000136847
Domain Number 1 Region: 36-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.41e-48
Family FAD-linked reductases, N-terminal domain 0.0000000103
Further Details:      
 
Domain Number 2 Region: 323-492
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.37e-28
Family GMC oxidoreductases 0.00000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000136847
Sequence length 553
Sequence
MENSAIAAILFLLYFFVFCPQLGVHSFATPSDVQDFSYLKFVRNATDLPLQEKYDYIVVG
GGTAGCPLAATLSANYSVLLLERGDIPTAYPNVLSNAGILANFMQEDDGKTPAQRFTSED
GVAFVRGRVLGGSSMINVGLYSRADSEFLKKSGIKLDMNLVNNSYEWVENTLVFRPNLSH
WQSVVKDALLEAGVRPDNGLTLDHIQGTKITGTIFDDRGRRHGAVELLNKGHPKNLRVAI
HAAVERIIFSSKASGLSAKGIIYTDSNGRSHQALIRGKGEVILSAGAIGSPQLLLLSGVG
PKSYLSSLKIPVVHPQPYVGQFMRDNPRXYVTILPPSELEPSTAQIAGITSDYYIETFSG
LPFSTMAFSLFPNPTIPMTINSTFGHIVTKNPAPLSYGSLKLQSSYDVKVGPXVKFNYFA
XKADLSRCVSAVRKMGDLLKTXXLKPFKXXDLPGEXGFNLFGPPLPMNXSDVASIETFCR
DTVATXWHYHGGCLVGKVVDGDFRVRGIKALRVVDGSVFKSLSPGTNPQATLMMLGRHVG
LRMLEERSACKGR
Download sequence
Identical sequences MDP0000136847 MDP0000136847|PACid:22626492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]