SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000140206 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000140206
Domain Number 1 Region: 408-614
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.41e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0053
Further Details:      
 
Domain Number 2 Region: 568-734
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0047
Further Details:      
 
Domain Number 3 Region: 744-832
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000000000961
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000140206
Sequence length 844
Sequence
MGISDYISGTTDSLKRNAPGLTAVKNLCSTAYGYGSGAVTQIDNAVRGNLNQYLGDAEGR
AKIVRFSSSIAKHTALESLKTVPGYKIVKRSISDLNETDEQEVNGKAMQADLRRLKKELS
EYRKVHELEVDVKALQTDILRLEKELSEYRKSHKQVQLDKPSADLKLPNTANIHSVANWK
PEDVIGVFMMKEVMGRKFLDDLMAFRGGPTKKCLKTLLDSNPRASQLFSTVCVITLGVPG
CVSGTLRKISCERSGEGAAFSGRKILVFWQSVKPGSKNSAMGILTRICERIMFIWYLIRR
WIKYQQNFEVINMNTLRRMLEELISQTECIVEKLDAEPLVPVIQQRDEVYDWLENAERIK
TQILTIEKLGERKFISRVHLAKLVDEKIGEVEELLKKGCLYNEICTKKSFKYVIIGGGVA
AGYAAREFVKQGLKPGELAIISKEAVAPYERPALSKAYLLPEGAARLPGFHVCVGSGGEK
LLPEWYAEKGIELLLSTEIVEADLHSKILTSETGGMFEFETLIIATGSRVLRLTEFGVQG
ADAKNIFYLREISDADKLVEAIKAKKNGKVVIIGGGYIGLEVGAAMRINKFDVTMVSRDP
WCMPRLFTKEIAAFYEGYYANKGVKIIKGTPAVSLDADTNGDVKAVKLKDGRVLQADIVV
VGVGAKPLTDLFKGQVDEENDGIRTDGMFETDVPYVYAVGDVATFPMKLYNDMRRVEHVD
HARKSAEHAVRAIRASEEGKCIDEYDYVPYFYSRAFNLSWTFYGDNVGDPLLFGDRDPTS
RKPKFGAAWIKDGRIVGTFLEGGTDEENKAIARVARAQPSAVHLDTLEREGSTLDISMLT
NSHL
Download sequence
Identical sequences MDP0000140206|PACid:22652348 MDP0000140206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]