SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000142434 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000142434
Domain Number 1 Region: 9-169,275-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.25e-47
Family FAD-linked reductases, N-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000142434
Sequence length 407
Sequence
MEVGDEEIGIAIVGGGICGLATALALHRKGFTSVVLERSESLRATGGGITIRANGWRALD
ELGVASKLRQTALPLQGARDIYXHNGKQQKISYGGAEARCLKRSDLITTLAESLPVGTIR
LGCQAISVKLDSLTSYPTLQLHNGSTIKAXVVIGCDGTKSVVADFIGVKPSKPFMLSEVR
GFTVYAGGHNFGNEFVQVKGDKNTIGRLPVHDNLVYWFVSHQVHGGQADPSKVSKDPELI
RQFTLQSILEEFPSEIVDMIRKSELESVSHVRLRYRPPWEIVVQNFRKGSVTVAGDAMHV
MGPFIGQGGSAGIEDAIVIARSLAPALAKNYYKKWSGRNGMMVEVGEAFDKYVKERRMRL
VMLSTQTYLLGLLQQDSGSMLKFVCLILMATLFSDVIRHTRYDCGRL
Download sequence
Identical sequences MDP0000142434|PACid:22683351 MDP0000142434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]