SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000143327 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000143327
Domain Number - Region: 82-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000678
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000143327
Sequence length 198
Sequence
MEVXGMISXDTFRGRVCECPIVQGVKFVGDGYTHCEASGALRCGINNGGCWKETRSGRTY
SACRDDHTNGCSCPPGFKGDGEKTCEDVDECKEKTACQCSQCKCKNTWGSYECSCGGGLL
YMRENDACIGKNGSGSGSSWGLIWVIILCLGAVGVGGFAVYKYRIRRYMDSEIRAIMAQY
MPLDNQGEVPSHVARGDI
Download sequence
Identical sequences MDP0000143327 MDP0000143327|PACid:22657920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]