SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000144808 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000144808
Domain Number 1 Region: 82-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000228
Family Myb/SANT domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000144808
Sequence length 200
Sequence
MKKSKDTWSNLVVEGHGFGPGFLAGHANLFHVILEKPVRSASDPLLSQLLPQAPGSKPVD
MNNSRNRNKNNRNQGEYQLKVKLVHETETKWSLIAGRLPGRTDNEIKNYWNSCLGKKMKQ
NRAVLKTEQESSEPNNIKAMEVNALTIEREDAFKREENFKFGLNVNEFFDCSGSDDGPLN
LEWMNKFVEMDESWFTLHDI
Download sequence
Identical sequences MDP0000144808|PACid:22654309 MDP0000153280|PACid:22642142 MDP0000144808 MDP0000153280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]