SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000147489 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000147489
Domain Number - Region: 14-85
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000712
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000147489
Sequence length 149
Sequence
MFVSPTFQDYILGSPKSILPLYRECIHGRIPQLAVIGFSESIPNLYASEMRCRWLAELLG
GTFKLPSIKEMEKDVEKWDAYAKRSDTLPANTTGDHASVPSICGTMTSCARKWDGTPKXR
RDSLLNCLSLMAPWIMLPLEMVNSNIIKD
Download sequence
Identical sequences MDP0000147489|PACid:22620352 MDP0000147489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]